PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G30000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 543aa    MW: 57049.3 Da    PI: 7.2144
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G30000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.2e-24163207145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  OPUNC03G30000.1 163 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 207
                      79****************************************986 PP

2QLQ57.54e-2097133137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+ +L++Q+l+yKyLaan PvP+ Ll +i++
  OPUNC03G30000.1  97 GPFTPSQWIELEHQALIYKYLAANSPVPHSLLIPIRR 133
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-1197133IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.1E-1598132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.08798133IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.455163207IPR014977WRC domain
PfamPF088791.9E-20164206IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MDLGGGVGAA AAAVSEAVKV AAPFLLGASC SPGHGGEQML SFSSSPSSCS SGGGAAVAAA  60
AAGGAMPLYY GTPASCSGLS SVSLSSSMQG AIARVRGPFT PSQWIELEHQ ALIYKYLAAN  120
SPVPHSLLIP IRRSLTSPYS PAYFGSSTLG WGSFQLGYSG SADPEPGRCR RTDGKKWRCS  180
RDAVADQKYC ERHMNRGRHR SRKHVEGQPG HAAKAMPAAV AAAAASATQP SAPAAQSGGG  240
VAGLAINHQQ QQMKNYAANT ANPCSLQYSR DLANKHNESE QVQDSDSLSM LTSMSTRNTG  300
SLFPFSKQHN PFEVTNSRPD FGLVSPDSLM SSPHSSLENV NLLTSQGLNE QQSSVSLQHF  360
VDWPRTPAQG ALAWPDAEDM QAQRSQLSIS APMASSDLSS ASTSPIHEKL MLSPLKLSRE  420
YSPIGLGSAA NRDEVNQGET NWTPMFRDSL MGGPLGEVLT KNNNMEARNC LSASLNLLND  480
GWDSSSGFDS SPVGVLQKTT FGSVSSSTGS SPRLENHSVY DGNSNLRDDL GSVVVNHPSI  540
RLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0735780.0AK073578.1 Oryza sativa Japonica Group cDNA clone:J033048N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628630.10.0PREDICTED: growth-regulating factor 6
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A0E0KIJ70.0A0A0E0KIJ7_ORYPU; Uncharacterized protein
STRINGBGIOSGA013499-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-49growth-regulating factor 2